INPP5B antibody (70R-2472)

Rabbit polyclonal INPP5B antibody raised against the middle region of INPP5B

Synonyms Polyclonal INPP5B antibody, Anti-INPP5B antibody, INPPB-5, MGC65156 antibody, INPPB 5, INPPB 5 antibody, INPP5B, Inositol Polyphosphate-5-Phosphatase 75Kda antibody, MGC71303 antibody, INPPB-5 antibody, 5PTase antibody
Specificity INPP5B antibody was raised against the middle region of INPP5B
Cross Reactivity Human,Mouse
Applications WB
Immunogen INPP5B antibody was raised using the middle region of INPP5B corresponding to a region with amino acids IHNGQVPCHFEFINKPDEESYCKQWLNANPSRGFLLPDSDVEIDLELFVN
Assay Information INPP5B Blocking Peptide, catalog no. 33R-3984, is also available for use as a blocking control in assays to test for specificity of this INPP5B antibody


Western Blot analysis using INPP5B antibody (70R-2472)

INPP5B antibody (70R-2472) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 77 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of INPP5B antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Cellular calcium signaling is controlled by the production of inositol phosphates (IPs) by phospholipase C in response to extracellular signals. The IP signaling molecules are inactivated by a family of inositol polyphosphate-5-phosphatases (5-phosphatases). INPP5B is the type II 5-phosphatase. The protein is localized to the cytosol and mitochondria, and associates with membranes through an isoprenyl modification near the C-terminus.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using INPP5B antibody (70R-2472) | INPP5B antibody (70R-2472) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors