INTS6 antibody (70R-4691)

Rabbit polyclonal INTS6 antibody raised against the C terminal of INTS6

Synonyms Polyclonal INTS6 antibody, Anti-INTS6 antibody, DDX26A antibody, DKFZP434B105 antibody, DDX26 antibody, DBI-1 antibody, INT6 antibody, Integrator Complex Subunit 6 antibody, Notchl2 antibody, DICE1 antibody, HDB antibody
Specificity INTS6 antibody was raised against the C terminal of INTS6
Cross Reactivity Human
Applications WB
Immunogen INTS6 antibody was raised using the C terminal of INTS6 corresponding to a region with amino acids GFLENHEEPRDKEQCAEENIPASSLNKGKKLMHCRSHEEVNTELKAQIMK
Assay Information INTS6 Blocking Peptide, catalog no. 33R-3261, is also available for use as a blocking control in assays to test for specificity of this INTS6 antibody


Western Blot analysis using INTS6 antibody (70R-4691)

INTS6 antibody (70R-4691) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 99 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of INTS6 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. INTS6 is a DEAD box protein that is part of a complex that interacts with the C-terminus of RNA polymerase II and is involved in 3' end processing of snRNAs. In addition, this gene is a candidate tumor suppressor and located in the critical region of loss of heterozygosity (LOH).

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using INTS6 antibody (70R-4691) | INTS6 antibody (70R-4691) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors