ISG20 antibody (70R-1340)

Rabbit polyclonal ISG20 antibody raised against the N terminal of ISG20

Synonyms Polyclonal ISG20 antibody, Anti-ISG20 antibody, ISG-20 antibody, ISG 20 antibody, ISG-20, Interferon Stimulated Exonuclease Gene 20Kda antibody, ISG20, ISG 20
Specificity ISG20 antibody was raised against the N terminal of ISG20
Cross Reactivity Human,Dog
Applications WB
Immunogen ISG20 antibody was raised using the N terminal of ISG20 corresponding to a region with amino acids GAVLYDKFIRPEGEITDYRTRVSGVTPQHMVGATPFAVARLEILQLLKGK
Assay Information ISG20 Blocking Peptide, catalog no. 33R-3179, is also available for use as a blocking control in assays to test for specificity of this ISG20 antibody


Western Blot analysis using ISG20 antibody (70R-1340)

ISG20 antibody (70R-1340) used at 1.25 ug/ml to detect target protein.


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 20 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of ISG20 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ISG20 belongs to the the exonuclease superfamily. It is exonuclease with specificity for single-stranded RNA and, to a lesser extent for DNA. It degrades RNA at a rate that is approximately 35-fold higher than its rate for single-stranded DNA. It is involved in the antiviral function of IFN against RNA viruses.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using ISG20 antibody (70R-1340) | ISG20 antibody (70R-1340) used at 1.25 ug/ml to detect target protein.

Availability: In stock

Price: £199.84
Size: 100 ug
View Our Distributors