ISYNA1 antibody (70R-2653)

Rabbit polyclonal ISYNA1 antibody raised against the N terminal of ISYNA1

Synonyms Polyclonal ISYNA1 antibody, Anti-ISYNA1 antibody, Myo-Inositol 1-Phosphate Synthase A1 antibody, ISYNA-1, ISYNA1, ISYNA-1 antibody, ISYNA 1 antibody, ISYNA 1
Specificity ISYNA1 antibody was raised against the N terminal of ISYNA1
Cross Reactivity Human
Applications WB
Immunogen ISYNA1 antibody was raised using the N terminal of ISYNA1 corresponding to a region with amino acids LQEQLWPHMEALRPRPSVYIPEFIAANQSARADNLIPGSRAQQLEQIRRD
Assay Information ISYNA1 Blocking Peptide, catalog no. 33R-5306, is also available for use as a blocking control in assays to test for specificity of this ISYNA1 antibody

Images

Western Blot analysis using ISYNA1 antibody (70R-2653)

ISYNA1 antibody (70R-2653) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 61 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ISYNA1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Myoinositol, the most common naturally occurring form of inositol, is a component of plasma membrane phospholipids and functions as a cell signaling molecule. ISYNA1 (EC 5.5.1.4), or IPS, is a rate-limiting enzyme that catalyzes the de novo synthesis of myoinositol 1-phosphate from glucose 6-phosphate.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using ISYNA1 antibody (70R-2653) | ISYNA1 antibody (70R-2653) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £276.43
Size: 50 ug
OR
Shipping
View Our Distributors