ITLN2 antibody (70R-4496)

Rabbit polyclonal ITLN2 antibody raised against the middle region of ITLN2

Synonyms Polyclonal ITLN2 antibody, Anti-ITLN2 antibody, HL2 antibody, ITLN 2 antibody, ITLN2, ITLN-2, Intelectin 2 antibody, ITLN 2, HL-2 antibody, ITLN-2 antibody
Specificity ITLN2 antibody was raised against the middle region of ITLN2
Cross Reactivity Human
Applications WB
Immunogen ITLN2 antibody was raised using the middle region of ITLN2 corresponding to a region with amino acids TVGDRWSSQQGNKADYPEGDGNWANYNTFGSAEAATSDDYKNPGYYDIQA
Assay Information ITLN2 Blocking Peptide, catalog no. 33R-9353, is also available for use as a blocking control in assays to test for specificity of this ITLN2 antibody


Western Blot analysis using ITLN2 antibody (70R-4496)

ITLN2 antibody (70R-4496) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 36 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ITLN2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ITLN2 may play a role in the defense system against pathogens.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using ITLN2 antibody (70R-4496) | ITLN2 antibody (70R-4496) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors