JOSD2 antibody (70R-4142)

Rabbit polyclonal JOSD2 antibody raised against the N terminal of JOSD2

Synonyms Polyclonal JOSD2 antibody, Anti-JOSD2 antibody, SBBI54 antibody, Josephin Domain Containing 2 antibody, FLJ29018 antibody
Specificity JOSD2 antibody was raised against the N terminal of JOSD2
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen JOSD2 antibody was raised using the N terminal of JOSD2 corresponding to a region with amino acids QQLFSQEAADEICKRLAPDSRLNPHRSLLGTGNYDVNVIMAALQGLGLAA
Assay Information JOSD2 Blocking Peptide, catalog no. 33R-7694, is also available for use as a blocking control in assays to test for specificity of this JOSD2 antibody


Western Blot analysis using JOSD2 antibody (70R-4142)

JOSD2 antibody (70R-4142) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 21 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of JOSD2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The specific function of JOSD2 is not yet known.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using JOSD2 antibody (70R-4142) | JOSD2 antibody (70R-4142) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors