KARS antibody (70R-4755)

Rabbit polyclonal KARS antibody raised against the C terminal of KARS

Synonyms Polyclonal KARS antibody, Anti-KARS antibody, Lysyl-tRNA Synthetase antibody
Specificity KARS antibody was raised against the C terminal of KARS
Cross Reactivity Human
Applications IHC, WB
Immunogen KARS antibody was raised using the C terminal of KARS corresponding to a region with amino acids GMGIDRVAMFLTDSNNIKEVLLFPAMKPEDKKENVATTDTLESTTVGTSV
Assay Information KARS Blocking Peptide, catalog no. 33R-3434, is also available for use as a blocking control in assays to test for specificity of this KARS antibody


Immunohistochemical staining using KARS antibody (70R-4755)

KARS antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of intestinal villus (arrows) in Human Intestine. Magnification is at 400X


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 66 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of KARS antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.25 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Aminoacyl-tRNA synthetases are a class of enzymes that charge tRNAs with their cognate amino acids. Lysyl-tRNA synthetase is a homodimer localized to the cytoplasm which belongs to the class II family of tRNA synthetases. It has been shown to be a target of autoantibodies in the human autoimmune diseases, polymyositis or dermatomyositis.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunohistochemical staining using KARS antibody (70R-4755) | KARS antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of intestinal villus (arrows) in Human Intestine. Magnification is at 400X
  • Western Blot analysis using KARS antibody (70R-4755) | KARS antibody (70R-4755) used at 0.25 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors