Karyopherin Alpha 3 antibody (70R-2090)

Rabbit polyclonal Karyopherin Alpha 3 antibody

Synonyms Polyclonal Karyopherin Alpha 3 antibody, Anti-Karyopherin Alpha 3 antibody, SRP1gamma antibody, Karyopherin Alpha -3 antibody, Karyopherin Alpha 3, Karyopherin Alpha 3 antibody, Karyopherin Alpha 3, KPNA3 antibody, hSRP1 antibody, Importin Alpha 4 antibody, SRP4 antibody, IPOA4 antibody, Karyopherin Alpha -3
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen Karyopherin Alpha 3 antibody was raised using a synthetic peptide corresponding to a region with amino acids AENPSLENHRIKSFKNKGRDVETMRRHRNEVTVELRKNKRDEHLLKKRNV
Assay Information Karyopherin Alpha 3 Blocking Peptide, catalog no. 33R-1141, is also available for use as a blocking control in assays to test for specificity of this Karyopherin Alpha 3 antibody


Western Blot analysis using Karyopherin Alpha 3 antibody (70R-2090)

Karyopherin Alpha 3 antibody (70R-2090) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 58 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of KPNA3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The transport of molecules between the nucleus and the cytoplasm in eukaryotic cells is mediated by the nuclear pore complex (NPC) which consists of 60-100 proteins and is probably 120 million daltons in molecular size. Small molecules (up to 70 kDa) can pass through the nuclear pore by nonselective diffusion; larger molecules are transported by an active process. Most nuclear proteins contain short basic amino acid sequences known as nuclear localization signals (NLSs). KPNA3 is a protein similar to certain nuclear transport proteins of Xenopus and human.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using Karyopherin Alpha 3 antibody (70R-2090) | Karyopherin Alpha 3 antibody (70R-2090) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors