Karyopherin Alpha 4 antibody (70R-2091)

Rabbit polyclonal Karyopherin Alpha 4 antibody

Synonyms Polyclonal Karyopherin Alpha 4 antibody, Anti-Karyopherin Alpha 4 antibody, MGC26703 antibody, Karyopherin Alpha 4, Importin Alpha 3 antibody, Karyopherin Alpha -4, MGC12217 antibody, Karyopherin Alpha 4 antibody, KPNA4 antibody, Karyopherin Alpha 4, Karyopherin Alpha -4 antibody, QIP1 antibody, IPOA3 antibody, SRP3 antibody
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen Karyopherin Alpha 4 antibody was raised using a synthetic peptide corresponding to a region with amino acids KNKRDEHLLKRRNVPHEDICEDSDIDGDYRVQNTSLEAIVQNASSDNQGI
Assay Information Karyopherin Alpha 4 Blocking Peptide, catalog no. 33R-4568, is also available for use as a blocking control in assays to test for specificity of this Karyopherin Alpha 4 antibody


Western Blot analysis using Karyopherin Alpha 4 antibody (70R-2091)

Karyopherin Alpha 4 antibody (70R-2091) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 58 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of KPNA4 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The nuclear import of karyophilic proteins is directed by short amino acid sequences termed nuclear localization signals (NLSs). Karyopherins, or importins, are cytoplasmic proteins that recognise NLSs and dock NLS-containing proteins to the nuclear pore complex. KPNA4 shares the sequence similarity with Xenopus importin-alpha and Saccharomyces cerevisiae Srp1. This protein is found to interact with the NLSs of DNA helicase Q1 and SV40 T antigen.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using Karyopherin Alpha 4 antibody (70R-2091) | Karyopherin Alpha 4 antibody (70R-2091) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors