KCNA1 antibody (70R-5148)

Rabbit polyclonal KCNA1 antibody raised against the middle region of KCNA1

Synonyms Polyclonal KCNA1 antibody, Anti-KCNA1 antibody, MK1 antibody, HUK1 antibody, KCNA1, AEMK antibody, MGC138385 antibody, KV1.1 antibody, KCNA-1 antibody, Potassium Voltage-Gated Channel Shaker-Related Subfamily Member 1 antibody, KCNA 1 antibody, KCNA-1, MBK1 antibody, HBK1 antibody, MGC126782 antibody, RBK1 antibody, EA1 antibody, KCNA 1
Specificity KCNA1 antibody was raised against the middle region of KCNA1
Cross Reactivity Human
Applications WB
Immunogen KCNA1 antibody was raised using the middle region of KCNA1 corresponding to a region with amino acids ISIVIFCLETLPELKDDKDFTGTVHRIDNTTVIYNSNIFTDPFFIVETLC
Assay Information KCNA1 Blocking Peptide, catalog no. 33R-4154, is also available for use as a blocking control in assays to test for specificity of this KCNA1 antibody

Images

Western Blot analysis using KCNA1 antibody (70R-5148)

KCNA1 antibody (70R-5148) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 56 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of KCNA1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance KCNA1 mediates the voltage-dependent potassium ion permeability of excitable membranes. Assuming opened or closed conformations in response to the voltage difference across the membrane, the protein forms a potassium-selective channel through which potassium ions may pass in accordance with their electrochemical gradient.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using KCNA1 antibody (70R-5148) | KCNA1 antibody (70R-5148) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
OR
Shipping
View Our Distributors