KCNA10 antibody (70R-1497)

Rabbit polyclonal KCNA10 antibody raised against the middle region of KCNA10

Synonyms Polyclonal KCNA10 antibody, Anti-KCNA10 antibody, KCNA 10, Potassium Voltage-Gated Channel Shaker-Related Subfamily Member 10 antibody, KCNA-10, KCNA 10 antibody, KCNA10, KCNA-10 antibody
Specificity KCNA10 antibody was raised against the middle region of KCNA10
Cross Reactivity Human,Mouse,Rat
Applications IHC, WB
Immunogen KCNA10 antibody was raised using the middle region of KCNA10 corresponding to a region with amino acids PANVPIDIFADEISFYELGSEAMDQFREDEGFIKDPETLLPTNDIHRQFW
Assay Information KCNA10 Blocking Peptide, catalog no. 33R-6970, is also available for use as a blocking control in assays to test for specificity of this KCNA10 antibody

Images

Immunohistochemical staining using KCNA10 antibody (70R-1497)

KCNA10 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X

Specifications

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 56 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of KCNA10 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Potassium channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Four sequence-related potassium channel genes, shaker, shaw, shab, and shal, have been identified in Drosophila, and each has been shown to have human homolog(s). KCNA10 encodes a member of the potassium channel, voltage-gated, shaker-related subfamily. This member contains six membrane-spanning domains with a shaker-type repeat in the fourth segment. It is specifically regulated by cGMP and postulated to mediate the effects of substances that increase intracellular cGMP.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Immunohistochemical staining using KCNA10 antibody (70R-1497) | KCNA10 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X
  • Western Blot analysis using KCNA10 antibody (70R-1497) | KCNA10 antibody (70R-1497) used at 1.25 ug/ml to detect target protein.

Availability: In stock

Price: £220.34
Size: 100 ug
OR
Shipping
View Our Distributors