KCNAB3 antibody (70R-1485)

Rabbit polyclonal KCNAB3 antibody raised against the N terminal of KCNAB3

Synonyms Polyclonal KCNAB3 antibody, Anti-KCNAB3 antibody, Potassium Voltage-Gated Channel Shaker-Related Subfamily Beta Member 3 antibody, KCNAB-3 antibody, KCNAB3, KCNAB 3, KCNAB 3 antibody, KCNAB-3
Specificity KCNAB3 antibody was raised against the N terminal of KCNAB3
Cross Reactivity Human, Dog
Applications IHC, WB
Immunogen KCNAB3 antibody was raised using the N terminal of KCNAB3 corresponding to a region with amino acids RNLGKSGLRVSCLGLGTWVTFGSQISDETAEDVLTVAYEHGVNLFDTAEV
Assay Information KCNAB3 Blocking Peptide, catalog no. 33R-8079, is also available for use as a blocking control in assays to test for specificity of this KCNAB3 antibody

Images

Immunohistochemical staining using KCNAB3 antibody (70R-1485)

KCNAB3 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X

Specifications

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 44 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of KCNAB3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.65 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. Four sequence-related potassium channel genes - shaker, shaw, shab, and shal - have been identified in Drosophila, and each has been shown to have human homolog(s).

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Immunohistochemical staining using KCNAB3 antibody (70R-1485) | KCNAB3 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X
  • Western Blot analysis using KCNAB3 antibody (70R-1485) | KCNAB3 antibody (70R-1485) used at 0.65 ug/ml to detect target protein.

Availability: In stock

Price: £220.34
Size: 100 ug
OR
Shipping
View Our Distributors