KCNC3 antibody (70R-5136)

Rabbit polyclonal KCNC3 antibody raised against the middle region of KCNC3

Synonyms Polyclonal KCNC3 antibody, Anti-KCNC3 antibody, KV3.3 antibody, KSHIIID antibody, KCNC-3, KCNC 3 antibody, KCNC-3 antibody, KCNC3, SCA13 antibody, KCNC 3, Potassium Voltage-Gated Channel Shaw-Related Subfamily Member 3 antibody
Specificity KCNC3 antibody was raised against the middle region of KCNC3
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen KCNC3 antibody was raised using the middle region of KCNC3 corresponding to a region with amino acids YAERIGADPDDILGSNHTYFKNIPIGFWWAVVTMTTLGYGDMYPKTWSGM
Assay Information KCNC3 Blocking Peptide, catalog no. 33R-10044, is also available for use as a blocking control in assays to test for specificity of this KCNC3 antibody

Images

Western Blot analysis using KCNC3 antibody (70R-5136)

KCNC3 antibody (70R-5136) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 80 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of KCNC3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The Shaker gene family of Drosophila encodes components of voltage-gated potassium channels and is comprised of four subfamilies. Based on sequence similarity, this gene is similar to one of these subfamilies, namely the Shaw subfamily. KCNC3 belongs to the delayed rectifier class of channel proteins and is an integral membrane protein that mediates the voltage-dependent potassium ion permeability of excitable membranes.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using KCNC3 antibody (70R-5136) | KCNC3 antibody (70R-5136) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
OR
Shipping
View Our Distributors