KCNH5 antibody (70R-1523)

Rabbit polyclonal KCNH5 antibody

Synonyms Polyclonal KCNH5 antibody, Anti-KCNH5 antibody, Potassium Voltage-Gated Channel Subfamily H antibody, KCNH5, KCNH 5 antibody, KCNH-5 antibody, Eag-Related 5 antibody, KCNH-5, KCNH 5
Cross Reactivity Human,Mouse,Rat,Dog,ZebraFish
Applications WB
Immunogen KCNH5 antibody was raised using a synthetic peptide corresponding to a region with amino acids IDLLSCLPYDIINAFENVDEGISSLFSSLKVVRLLRLGRVARKLDHYLEY
Assay Information KCNH5 Blocking Peptide, catalog no. 33R-3919, is also available for use as a blocking control in assays to test for specificity of this KCNH5 antibody


Western Blot analysis using KCNH5 antibody (70R-1523)

KCNH5 antibody (70R-1523) used at 1.25 ug/ml to detect target protein.


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 69 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of KCNH5 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene encodes a member of the potassium channel, voltage-gated, subfamily H. This member is a pore-forming (alpha) subunit of a voltage-gated non-inactivating delayed rectifier potassium channel. This gene is not expressed in differentiating myoblasts.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using KCNH5 antibody (70R-1523) | KCNH5 antibody (70R-1523) used at 1.25 ug/ml to detect target protein.

Availability: In stock

Price: £199.84
Size: 100 ug
View Our Distributors