KCNIP2 antibody (70R-5098)

Rabbit polyclonal KCNIP2 antibody raised against the N terminal of KCNIP2

Synonyms Polyclonal KCNIP2 antibody, Anti-KCNIP2 antibody, KCHIP2 antibody, KCNIP 2 antibody, KCNIP2, DKFZp566L1246 antibody, KCNIP 2, MGC17241 antibody, KCNIP-2 antibody, Kv Channel Interacting Protein 2 antibody, KCNIP-2
Specificity KCNIP2 antibody was raised against the N terminal of KCNIP2
Cross Reactivity Human,Rat
Applications IHC, WB
Immunogen KCNIP2 antibody was raised using the N terminal of KCNIP2 corresponding to a region with amino acids QLTDSVDDEFELSTVCHRPEGLEQLQEQTKFTRKELQVLYRGFKNPGALS
Assay Information KCNIP2 Blocking Peptide, catalog no. 33R-7647, is also available for use as a blocking control in assays to test for specificity of this KCNIP2 antibody

Images

Immunohistochemical staining using KCNIP2 antibody (70R-5098)

Human Brain

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 21 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of KCNIP2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.06 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance KCNIP2 encodes a member of the family of voltage-gated potassium (Kv) channel-interacting proteins (KCNIPs), which belongs to the recoverin branch of the EF-hand superfamily. Members of the KCNIP family are small calcium binding proteins. They all have EF-hand-like domains, and differ from each other in the N-terminus. They are integral subunit components of native Kv4 channel complexes. They may regulate A-type currents, and hence neuronal excitability, in response to changes in intracellular calcium.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Immunohistochemical staining using KCNIP2 antibody (70R-5098) | Human Brain
  • Western blot analysis using KCNIP2 antibody (70R-5098) | Recommended KCNIP2 Antibody Titration: 0.06ug/ml

Availability: In stock

Price: £250.71
Size: 50 ug
OR
Shipping
View Our Distributors