KCNJ4 antibody (70R-5138)

Rabbit polyclonal KCNJ4 antibody raised against the middle region of KCNJ4

Synonyms Polyclonal KCNJ4 antibody, Anti-KCNJ4 antibody, Kir2.3 antibody, HIRK2 antibody, HIR antibody, MGC142068 antibody, MGC142066 antibody, IRK3 antibody, KCNJ-4 antibody, KCNJ 4 antibody, KCNJ 4, Potassium Inwardly-Rectifying Channel Subfamily J Member 4 antibody, KCNJ4, HRK1 antibody, KCNJ-4
Specificity KCNJ4 antibody was raised against the middle region of KCNJ4
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen KCNJ4 antibody was raised using the middle region of KCNJ4 corresponding to a region with amino acids AVAAGLGLEAGSKEEAGIIRMLEFGSHLDLERMQASLPLDNISYRRESAI
Assay Information KCNJ4 Blocking Peptide, catalog no. 33R-1580, is also available for use as a blocking control in assays to test for specificity of this KCNJ4 antibody


Western Blot analysis using KCNJ4 antibody (70R-5138)

KCNJ4 antibody (70R-5138) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 49 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of KCNJ4 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance KCNJ4 is an integral membrane protein and member of the inward rectifier potassium channel family. The encoded protein has a small unitary conductance compared to other members of this protein family.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using KCNJ4 antibody (70R-5138) | KCNJ4 antibody (70R-5138) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors