KCNJ8 antibody (70R-5131)

Rabbit polyclonal KCNJ8 antibody raised against the middle region of KCNJ8

Synonyms Polyclonal KCNJ8 antibody, Anti-KCNJ8 antibody, KCNJ8, Potassium Inwardly-Rectifying Channel Subfamily J Member 8 antibody, uKATP-1 antibody, KIR6.1 antibody, KCNJ-8, KCNJ-8 antibody, KCNJ 8, KCNJ 8 antibody
Specificity KCNJ8 antibody was raised against the middle region of KCNJ8
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen KCNJ8 antibody was raised using the middle region of KCNJ8 corresponding to a region with amino acids EKPSILIQTLQKSELSHQNSLRKRNSMRRNNSMRRNNSIRRNNSSLMVPK
Assay Information KCNJ8 Blocking Peptide, catalog no. 33R-2518, is also available for use as a blocking control in assays to test for specificity of this KCNJ8 antibody

Images

Western blot analysis using KCNJ8 antibody (70R-5131)

Recommended KCNJ8 Antibody Titration: 0.2-1 ug/ml

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 48 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of KCNJ8 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Potassium channels are present in most mammalian cells, where they participate in a wide range of physiologic responses. KCNJ8 is an integral membrane protein and inward-rectifier type potassium channel. KCNJ8, which has a greater tendency to allow potassium to flow into a cell rather than out of a cell, is controlled by G-proteins.Potassium channels are present in most mammalian cells, where they participate in a wide range of physiologic responses.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western blot analysis using KCNJ8 antibody (70R-5131) | Recommended KCNJ8 Antibody Titration: 0.2-1 ug/ml

Availability: In stock

Price: £250.71
Size: 50 ug
OR
Shipping
View Our Distributors