KCNK10 antibody (70R-1533)
Rabbit polyclonal KCNK10 antibody raised against the C terminal of KCNK10
Overview
Overview
Synonyms | Polyclonal KCNK10 antibody, Anti-KCNK10 antibody, KCNK-10 antibody, Potassium Channel Subfamily K Member 10 antibody, KCNK 10 antibody, KCNK-10, KCNK 10, KCNK10 |
---|---|
Specificity | KCNK10 antibody was raised against the C terminal of KCNK10 |
Cross Reactivity | Human |
Applications | WB |
Immunogen | KCNK10 antibody was raised using the C terminal of KCNK10 corresponding to a region with amino acids QGASEDNIINKFGSTSRLTKRKNKDLKKTLPEDVQKIYKTFRNYSLDEEK |
Assay Information | KCNK10 Blocking Peptide, catalog no. 33R-7555, is also available for use as a blocking control in assays to test for specificity of this KCNK10 antibody |
Images
Western Blot analysis using KCNK10 antibody (70R-1533)
KCNK10 antibody (70R-1533) used at 1.4 ug/ml to detect target protein.
Specifications
Host | Rabbit |
---|---|
Method of Purification | Total IgG Protein A purified |
Molecular Weight | 59 kDa (MW of target protein) |
Form & Buffer | Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of KCNK10 antibody in PBS |
Concentration | 1 mg/ml |
Usage & Assay Information
Usage Recommendations | WB: 1.4 ug/ml |
---|
Storage & Safety
Storage | Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles. |
---|
General Information
Biological Significance | KCNK10 is one of the members of the superfamily of potassium channel proteins containing two pore-forming P domains. The message for this gene is highly expressed in the kidney and pancreas. This channel is an open rectifier which primarily passes outward current under physiological K+ concentrations. The protein is stimulated strongly by arachidonic acid and to a lesser degree by membrane stretching, intracellular acidification, and general anaesthetics. Three transcript variants have been identified for this gene. |
---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product