KCNK12 antibody (70R-5130)

Rabbit polyclonal KCNK12 antibody raised against the middle region of KCNK12

Synonyms Polyclonal KCNK12 antibody, Anti-KCNK12 antibody, THIK-2 antibody, THIK2 antibody, KCNK-12 antibody, KCNK12, KCNK 12, KCNK-12, KCNK 12 antibody, Potassium Channel Subfamily K Member 12 antibody
Specificity KCNK12 antibody was raised against the middle region of KCNK12
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen KCNK12 antibody was raised using the middle region of KCNK12 corresponding to a region with amino acids EGRRLSGELISMRDLTASNKVSLALLQKQLSETANGYPRSVCVNTRQNGF
Assay Information KCNK12 Blocking Peptide, catalog no. 33R-2445, is also available for use as a blocking control in assays to test for specificity of this KCNK12 antibody

Images

Western Blot analysis using KCNK12 antibody (70R-5130)

KCNK12 antibody (70R-5130) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 47 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of KCNK12 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance KCNK12 is a member of the superfamily of potassium channel proteins containing two pore-forming P domains. KCNK12 has not been shown to be a functional channel, however, it may require other non-pore-forming proteins for activity.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using KCNK12 antibody (70R-5130) | KCNK12 antibody (70R-5130) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
OR
Shipping
View Our Distributors