KCNK13 antibody (70R-5226)

Rabbit polyclonal KCNK13 antibody raised against the C terminal of KCNK13

Synonyms Polyclonal KCNK13 antibody, Anti-KCNK13 antibody, Potassium Channel Subfamily K Member 13 antibody, KCNK 13, KCNK13, KCNK-13 antibody, KCNK-13, KCNK 13 antibody
Specificity KCNK13 antibody was raised against the C terminal of KCNK13
Cross Reactivity Human
Applications IHC, WB
Immunogen KCNK13 antibody was raised using the C terminal of KCNK13 corresponding to a region with amino acids GEMISMKDLLAANKASLAILQKQLSEMANGCPHQTSTLARDNEFSGGVGA
Assay Information KCNK13 Blocking Peptide, catalog no. 33R-3237, is also available for use as a blocking control in assays to test for specificity of this KCNK13 antibody


Immunohistochemical staining using KCNK13 antibody (70R-5226)

KCNK13 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Neural cells (arrows) in Human Brain. Magnification is at 400X


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 45 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of KCNK13 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.12 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance KCNK13 encodes one of the members of the superfamily of potassium channel proteins containing two pore-forming domains. The product of this gene is an open channel that can be stimulated by arachidonic acid.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunohistochemical staining using KCNK13 antibody (70R-5226) | KCNK13 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Neural cells (arrows) in Human Brain. Magnification is at 400X
  • Western Blot analysis using KCNK13 antibody (70R-5226) | KCNK13 antibody (70R-5226) used at 0.12 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors