KCNN2 antibody (70R-5106)

Rabbit polyclonal KCNN2 antibody raised against the middle region of KCNN2

Synonyms Polyclonal KCNN2 antibody, Anti-KCNN2 antibody, SK2 antibody, Potassium Intermediate/Small Conductance Calcium-Activated Channel Subfamily N Member 2 antibody, KCa2.2 antibody, SKCA2 antibody, KCNN 2, KCNN-2 antibody, KCNN2, hSK2 antibody, KCNN 2 antibody, KCNN-2
Specificity KCNN2 antibody was raised against the middle region of KCNN2
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen KCNN2 antibody was raised using the middle region of KCNN2 corresponding to a region with amino acids KNAAANVLRETWLIYKNTKLVKKIDHAKVRKHQRKFLQAIHQLRSVKMEQ
Assay Information KCNN2 Blocking Peptide, catalog no. 33R-4564, is also available for use as a blocking control in assays to test for specificity of this KCNN2 antibody

Images

Western Blot analysis using KCNN2 antibody (70R-5106)

KCNN2 antibody (70R-5106) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 26 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of KCNN2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance KCNN2 is an integral membrane protein that forms a voltage-independent calcium-activated channel with three other calmodulin-binding subunits. This protein is a member of the KCNN family of potassium channel genes. Two transcript variants encoding different isoforms have been found for KCNN2.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using KCNN2 antibody (70R-5106) | KCNN2 antibody (70R-5106) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
OR
Shipping
View Our Distributors