KCNQ1 antibody (70R-1537)

Rabbit polyclonal KCNQ1 antibody raised against the N terminal of KCNQ1

Synonyms Polyclonal KCNQ1 antibody, Anti-KCNQ1 antibody, KCNQ-1, KCNQ1, Potassium Voltage-Gated Channel Kqt-Like Subfamily Member 1 antibody, KCNQ 1 antibody, KCNQ-1 antibody, KCNQ 1
Specificity KCNQ1 antibody was raised against the N terminal of KCNQ1
Cross Reactivity Human, Mouse, Rat, Dog
Applications WB
Immunogen KCNQ1 antibody was raised using the N terminal of KCNQ1 corresponding to a region with amino acids IVVVASMVVLCVGSKGQVFATSAIRGIRFLQILRMLHVDRQGGTWRLLGS
Assay Information KCNQ1 Blocking Peptide, catalog no. 33R-4211, is also available for use as a blocking control in assays to test for specificity of this KCNQ1 antibody


Western Blot analysis using KCNQ1 antibody (70R-1537)

KCNQ1 antibody (70R-1537) used at 1.25 ug/ml to detect target protein.


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 60 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of KCNQ1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance KCNQ1 encodes a protein for a voltage-gated potassium channel required for the repolarization phase of the cardiac action potential. The gene product can form heteromultimers with two other potassium channel proteins, KCNE1 and KCNE3. Mutations in KCNQ1 are associated with hereditary long QT syndrome, Romano-Ward syndrome, Jervell and Lange-Nielsen syndrome and familial atrial fibrillation.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using KCNQ1 antibody (70R-1537) | KCNQ1 antibody (70R-1537) used at 1.25 ug/ml to detect target protein.

Availability: In stock

Price: £199.84
Size: 100 ug
View Our Distributors