KCNQ1 antibody (70R-5042)

Rabbit polyclonal KCNQ1 antibody raised against the N terminal of KCNQ1

Synonyms Polyclonal KCNQ1 antibody, Anti-KCNQ1 antibody, KVLQT1 antibody, Potassium Voltage-Gated Channel Kqt-Like Subfamily Member 1 antibody, ATFB1 antibody, Kv1.9 antibody, WRS antibody, RWS antibody, FLJ26167 antibody, KCNA9 antibody, LQT antibody, Kv7.1 antibody, KCNQ-1 antibody, KCNQ 1, JLNS1 antibody, KCNQ1, KCNQ 1 antibody, KCNQ-1, SQT2 antibody, KCNA8 antibody, LQT1 antibody
Specificity KCNQ1 antibody was raised against the N terminal of KCNQ1
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen KCNQ1 antibody was raised using the N terminal of KCNQ1 corresponding to a region with amino acids RSKYVGLWGRLRFARKPISIIDLIVVVASMVVLCVGSKGQVFATSAIRGI
Assay Information KCNQ1 Blocking Peptide, catalog no. 33R-8193, is also available for use as a blocking control in assays to test for specificity of this KCNQ1 antibody


Immunohistochemical staining using KCNQ1 antibody (70R-5042)

KCNQ1 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 64 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of KCNQ1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. KCNG1 is a member of the potassium channel, voltage-gated, subfamily G. Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunohistochemical staining using KCNQ1 antibody (70R-5042) | KCNQ1 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X
  • Western Blot analysis using KCNQ1 antibody (70R-5042) | KCNQ1 antibody (70R-5042) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors