KCNRG antibody (70R-5088)

Rabbit polyclonal KCNRG antibody raised against the N terminal of KCNRG

Synonyms Polyclonal KCNRG antibody, Anti-KCNRG antibody, Potassium Channel Regulator antibody, DLTET antibody
Specificity KCNRG antibody was raised against the N terminal of KCNRG
Cross Reactivity Human
Applications WB
Immunogen KCNRG antibody was raised using the N terminal of KCNRG corresponding to a region with amino acids TEFSDYLRLQREALFYELRSLVDLLNPYLLQPRPALVEVHFLSRNTQAFF
Assay Information KCNRG Blocking Peptide, catalog no. 33R-9036, is also available for use as a blocking control in assays to test for specificity of this KCNRG antibody


Western Blot analysis using KCNRG antibody (70R-5088)

KCNRG antibody (70R-5088) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 26 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of KCNRG antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance KCNRG is a soluble protein with characteristics suggesting it forms heterotetramers with voltage-gated K(+) channels and inhibits their function.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using KCNRG antibody (70R-5088) | KCNRG antibody (70R-5088) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors