KCNV1 antibody (70R-5123)

Rabbit polyclonal KCNV1 antibody raised against the N terminal of KCNV1

Synonyms Polyclonal KCNV1 antibody, Anti-KCNV1 antibody, HNKA antibody, KCNV 1, KCNV1, KCNB3 antibody, KCNV 1 antibody, KCNV-1, Potassium Channel Subfamily V Member 1 antibody, KV8.1 antibody, KV2.3 antibody, KCNV-1 antibody
Specificity KCNV1 antibody was raised against the N terminal of KCNV1
Cross Reactivity Human
Applications WB
Immunogen KCNV1 antibody was raised using the N terminal of KCNV1 corresponding to a region with amino acids ALGDCFTVNVGGSRFVLSQQALSCFPHTRLGKLAVVVASYRRPGALAAVP
Assay Information KCNV1 Blocking Peptide, catalog no. 33R-1332, is also available for use as a blocking control in assays to test for specificity of this KCNV1 antibody


Western Blot analysis using KCNV1 antibody (70R-5123)

KCNV1 antibody (70R-5123) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 56 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of KCNV1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. KCNV1 is a member of the potassium voltage-gated channel subfamily V. This protein is essentially present in the brain, and its role might be to inhibit the function of a particular class of outward rectifier potassium channel types.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using KCNV1 antibody (70R-5123) | KCNV1 antibody (70R-5123) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors