KCTD10 antibody (70R-1503)

Rabbit polyclonal KCTD10 antibody raised against the N terminal of KCTD10

Synonyms Polyclonal KCTD10 antibody, Anti-KCTD10 antibody, KCTD 10, KCTD-10, KCTD 10 antibody, KCTD10, KCTD-10 antibody, Potassium Channel Tetramerisation Domain Containing 10 antibody
Specificity KCTD10 antibody was raised against the N terminal of KCTD10
Cross Reactivity Human, Dog
Applications WB
Immunogen KCTD10 antibody was raised using the N terminal of KCTD10 corresponding to a region with amino acids MEEMSGESVVSSAVPAAATRTTSFKGTSPSSKYVKLNVGGALYYTTMQTL
Assay Information KCTD10 Blocking Peptide, catalog no. 33R-5908, is also available for use as a blocking control in assays to test for specificity of this KCTD10 antibody

Images

Western Blot analysis using KCTD10 antibody (70R-1503)

KCTD10 antibody (70R-1503) used at 1.25 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 34 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of KCTD10 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance KCTD10, a rat potassium channel tetramerisation domain-containing 10 gene is a novel member of the polymerase delta-interacting protein 1 (PDIP1) gene family. KCTD10 shares significant similarity in amino acid sequence to PDIP1 and can interact with the small subunit of DNA polymerase delta and PCNA as PDIP1 does. Like PDIP1, the expression of KCTD10 gene can be induced by TNF-alpha in NIH3T3 cells.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using KCTD10 antibody (70R-1503) | KCTD10 antibody (70R-1503) used at 1.25 ug/ml to detect target protein.

Availability: In stock

Price: £220.34
Size: 100 ug
OR
Shipping
View Our Distributors