KCTD11 antibody (70R-1493)

Rabbit polyclonal KCTD11 antibody raised against the N terminal of KCTD11

Synonyms Polyclonal KCTD11 antibody, Anti-KCTD11 antibody, KCTD11, KCTD-11, KCTD 11, Potassium Channel Tetramerisation Domain Containing 11 antibody, KCTD-11 antibody, KCTD 11 antibody
Specificity KCTD11 antibody was raised against the N terminal of KCTD11
Cross Reactivity Human
Applications WB
Immunogen KCTD11 antibody was raised using the N terminal of KCTD11 corresponding to a region with amino acids ADFYQIRPLLDALRELEASQGTPAPTAALLHADVDVSPRLVHFSARRGPH
Assay Information KCTD11 Blocking Peptide, catalog no. 33R-1090, is also available for use as a blocking control in assays to test for specificity of this KCTD11 antibody


Western Blot analysis using KCTD11 antibody (70R-1493)

KCTD11 antibody (70R-1493) used at 1.25 ug/ml to detect target protein.


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 26 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of KCTD11 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The KCTD11 gene encodes a protein that has been identified as a suppressor of Hedgehog signaling. Its inactivation might lead to a deregulation of the tumor-promoting Hedgehog pathway in medulloblastoma.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using KCTD11 antibody (70R-1493) | KCTD11 antibody (70R-1493) used at 1.25 ug/ml to detect target protein.

Availability: In stock

Price: £199.84
Size: 100 ug
View Our Distributors