KCTD15 antibody (70R-5046)

Rabbit polyclonal KCTD15 antibody raised against the N terminal of KCTD15

Synonyms Polyclonal KCTD15 antibody, Anti-KCTD15 antibody, Potassium Channel Tetramerisation Domain Containing 15 antibody, KCTD 15, MGC2628 antibody, KCTD-15 antibody, KCTD 15 antibody, KCTD-15, MGC25497 antibody, KCTD15
Specificity KCTD15 antibody was raised against the N terminal of KCTD15
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen KCTD15 antibody was raised using the N terminal of KCTD15 corresponding to a region with amino acids PVSPLAAQGIPLPAQLTKSNAPVHIDVGGHMYTSSLATLTKYPDSRISRL
Assay Information KCTD15 Blocking Peptide, catalog no. 33R-7424, is also available for use as a blocking control in assays to test for specificity of this KCTD15 antibody


Western blot analysis using KCTD15 antibody (70R-5046)

Recommended KCTD15 Antibody Titration: 0.2-1 ug/ml


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 26 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of KCTD15 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance KCTD15 contains 1 BTB (POZ) domain. The exact function of KCTD15 is not known.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western blot analysis using KCTD15 antibody (70R-5046) | Recommended KCTD15 Antibody Titration: 0.2-1 ug/ml

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors