KCTD18 antibody (70R-1504)

Rabbit polyclonal KCTD18 antibody raised against the N terminal of KCTD18

Synonyms Polyclonal KCTD18 antibody, Anti-KCTD18 antibody, KCTD 18, KCTD 18 antibody, Potassium Channel Tetramerisation Domain Containing 18 antibody, KCTD-18 antibody, KCTD-18, KCTD18
Specificity KCTD18 antibody was raised against the N terminal of KCTD18
Cross Reactivity Human
Applications WB
Immunogen KCTD18 antibody was raised using the N terminal of KCTD18 corresponding to a region with amino acids LHYLNTSGASCESRIIGVYATKTDGTDAIEKQLGGRIHSKGIFKREAGNN
Assay Information KCTD18 Blocking Peptide, catalog no. 33R-5035, is also available for use as a blocking control in assays to test for specificity of this KCTD18 antibody


Western Blot analysis using KCTD18 antibody (70R-1504)

KCTD18 antibody (70R-1504) used at 5 ug/ml to detect target protein.


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 47 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of KCTD18 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of Anti-KCTD18 has not yet been determined.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using KCTD18 antibody (70R-1504) | KCTD18 antibody (70R-1504) used at 5 ug/ml to detect target protein.

Availability: In stock

Price: £199.84
Size: 100 ug
View Our Distributors