KCTD7 antibody (70R-5085)

Rabbit polyclonal KCTD7 antibody raised against the N terminal of KCTD7

Synonyms Polyclonal KCTD7 antibody, Anti-KCTD7 antibody, KCTD-7 antibody, KCTD 7, KCTD-7, FLJ32069 antibody, KCTD7, KCTD 7 antibody, Potassium Channel Tetramerisation Domain Containing 7 antibody
Specificity KCTD7 antibody was raised against the N terminal of KCTD7
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen KCTD7 antibody was raised using the N terminal of KCTD7 corresponding to a region with amino acids VVVTGREPDSRRQDGAMSSSDAEDDFLEPATPTATQAGHALPLLPQEFPE
Assay Information KCTD7 Blocking Peptide, catalog no. 33R-9904, is also available for use as a blocking control in assays to test for specificity of this KCTD7 antibody


Western Blot analysis using KCTD7 antibody (70R-5085)

KCTD7 antibody (70R-5085) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 33 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of KCTD7 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The KCTD gene family, including KCTD7, encode predicted proteins that contain N-terminal domain that is homologous to the T1 domain in voltage-gated potassium channels. KCTD7 displays a primary sequence and hydropathy profile indicating intracytoplasmic localization. EST database analysis showed that KCTD7 is expressed in human and mouse brain.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using KCTD7 antibody (70R-5085) | KCTD7 antibody (70R-5085) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors