KCTD9 antibody (70R-3906)

Rabbit polyclonal KCTD9 antibody raised against the middle region of KCTD9

Synonyms Polyclonal KCTD9 antibody, Anti-KCTD9 antibody, Potassium Channel Tetramerisation Domain Containing 9 antibody, FLJ20038 antibody, KCTD9, KCTD 9,KCTD-9,KCTD 9 antibody, KCTD-9 antibody
Specificity KCTD9 antibody was raised against the middle region of KCTD9
Cross Reactivity Human
Applications WB
Immunogen KCTD9 antibody was raised using the middle region of KCTD9 corresponding to a region with amino acids AHANLCCANLERADLSGSVLDCANLQGVKMLCSNAEGASLKLCNFEDPSG
Assay Information KCTD9 Blocking Peptide, catalog no. 33R-1239, is also available for use as a blocking control in assays to test for specificity of this KCTD9 antibody

Images

Western Blot analysis using KCTD9 antibody (70R-3906)

KCTD9 antibody (70R-3906) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 42 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of KCTD9 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of KCTD9 protein is not widely studied, and is yet to be elucidated fully.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using KCTD9 antibody (70R-3906) | KCTD9 antibody (70R-3906) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
OR
Shipping
View Our Distributors