KHDRBS3 antibody (70R-4610)

Rabbit polyclonal KHDRBS3 antibody raised against the C terminal of KHDRBS3

Synonyms Polyclonal KHDRBS3 antibody, Anti-KHDRBS3 antibody, KHDRBS-3, KHDRBS 3, KHDRBS-3 antibody, Kh Domain Containing Rna Binding Signal Transduction Associated 3 antibody, KHDRBS 3 antibody, KHDRBS3
Specificity KHDRBS3 antibody was raised against the C terminal of KHDRBS3
Cross Reactivity Human
Applications IHC, WB
Immunogen KHDRBS3 antibody was raised using the C terminal of KHDRBS3 corresponding to a region with amino acids EQSYDSYDNSYSTPAQSGADYYDYGHGLSEETYDSYGQEEWTNSRHKAPS
Assay Information KHDRBS3 Blocking Peptide, catalog no. 33R-2680, is also available for use as a blocking control in assays to test for specificity of this KHDRBS3 antibody


Immunohistochemical staining using KHDRBS3 antibody (70R-4610)

KHDRBS3 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 38 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of KHDRBS3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.25 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance As a RNA-binding protein, KHDRBS3 plays a role in the regulation of alternative splicing and influences mRNA splice site selection and exon inclusion. KHDRBS3 may play a role as a negative regulator of cell growth. It inhibits cell proliferation and involved in splice site selection of vascular endothelial growth factor. It induces an increased concentration-dependent incorporation of exon in CD44 pre-mRNA by direct binding to purine-rich exonic enhancer. RNA-binding abilities are down-regulated by tyrosine kinase PTK6. It also involved in post-transcriptional regulation of HIV-1 gene expression.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunohistochemical staining using KHDRBS3 antibody (70R-4610) | KHDRBS3 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X
  • Western Blot analysis using KHDRBS3 antibody (70R-4610) | KHDRBS3 antibody (70R-4610) used at 0.25 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors