KHK antibody (70R-2644)

Rabbit polyclonal KHK antibody

Synonyms Polyclonal KHK antibody, Anti-KHK antibody, Fructokinase antibody, Ketohexokinase antibody
Cross Reactivity Human
Applications IHC, WB
Immunogen KHK antibody was raised using a synthetic peptide corresponding to a region with amino acids FQSAEEALRGLYGRVRKGAVLVCAWAEEGADALGPDGKLLHSDAFPPPRV
Assay Information KHK Blocking Peptide, catalog no. 33R-3036, is also available for use as a blocking control in assays to test for specificity of this KHK antibody


Immunohistochemical staining using KHK antibody (70R-2644)

KHK antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 33 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of KHK antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance KHK is a ketohexokinase that catalyzes conversion of fructose to fructose-1-phosphate. The product of this gene is the first enzyme with a specialized pathway that catabolizes dietary fructose.KHK encodes the gene ketohexokinase that catalyzes conversion of fructose to fructose-1-phosphate. The splice variant presented encodes the highly active form found in liver, renal cortex, and small intestine, while the alternate variant encodes the lower activity form found in most other tissues.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunohistochemical staining using KHK antibody (70R-2644) | KHK antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X
  • Western Blot analysis using KHK antibody (70R-2644) | KHK antibody (70R-2644) used at 1 ug/ml to detect target protein.
  • Immunohistochemical staining using KHK antibody (70R-2644) | KHK antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X

Availability: In stock

Price: £276.43
Size: 50 ug
View Our Distributors