KHK antibody (70R-2683)

Rabbit polyclonal KHK antibody

Synonyms Polyclonal KHK antibody, Anti-KHK antibody, Ketohexokinase antibody, Fructokinase antibody
Cross Reactivity Human
Applications WB
Immunogen KHK antibody was raised using a synthetic peptide corresponding to a region with amino acids FLVADFRRRGVDVSQVAWQSKGDTPSSCCIINNSNGNRTIVLHDTSLPDV
Assay Information KHK Blocking Peptide, catalog no. 33R-2992, is also available for use as a blocking control in assays to test for specificity of this KHK antibody


Western Blot analysis using KHK antibody (70R-2683)

KHK antibody (70R-2683) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 32 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of KHK antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance KHK is a ketohexokinase that catalyzes conversion of fructose to fructose-1-phosphate. The product of this gene is the first enzyme with a specialized pathway that catabolizes dietary fructose.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using KHK antibody (70R-2683) | KHK antibody (70R-2683) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £276.43
Size: 50 ug
View Our Distributors