KIAA0020 antibody (70R-1443)

Rabbit polyclonal KIAA0020 antibody raised against the N terminal of KIAA0020

Synonyms Polyclonal KIAA0020 antibody, Anti-KIAA0020 antibody, KIAA0020, KIAA00 20 antibody, Kiaa0020 antibody, KIAA00-20, KIAA00 20, KIAA00-20 antibody
Specificity KIAA0020 antibody was raised against the N terminal of KIAA0020
Cross Reactivity Human
Applications IHC, WB
Immunogen KIAA0020 antibody was raised using the N terminal of KIAA0020 corresponding to a region with amino acids GKKGVKQFKNKQQGDKSPKNKFQPANKFNKKRKFQPDGRSDESAAKKPKW
Assay Information KIAA0020 Blocking Peptide, catalog no. 33R-3368, is also available for use as a blocking control in assays to test for specificity of this KIAA0020 antibody


Western Blot analysis using KIAA0020 antibody (70R-1443)

KIAA0020 antibody (70R-1443) used at 1.25 ug/ml to detect target protein.


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 71 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of KIAA0020 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance KIAA0020 contains 6 pumilio repeats and 1PUM-HD domain. The function remains unknown.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using KIAA0020 antibody (70R-1443) | KIAA0020 antibody (70R-1443) used at 1.25 ug/ml to detect target protein.

Availability: In stock

Price: £220.34
Size: 100 ug
View Our Distributors