KIAA0157 antibody (70R-4247)

Rabbit polyclonal KIAA0157 antibody raised against the middle region of Kiaa0157

Synonyms Polyclonal KIAA0157 antibody, Anti-KIAA0157 antibody, KIAA0 157, KIAA0157, KIAA0-157, ABRO1 antibody, KIAA0 157 antibody, FLJ22338 antibody, KIAA0-157 antibody
Specificity KIAA0157 antibody was raised against the middle region of Kiaa0157
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen KIAA0157 antibody was raised using the middle region of Kiaa0157 corresponding to a region with amino acids GDSGEDSDDSDYENLIDPTEPSNSEYSHSKDSRPMAHPDEDPRNTQTSQI
Assay Information KIAA0157 Blocking Peptide, catalog no. 33R-3211, is also available for use as a blocking control in assays to test for specificity of this KIAA0157 antibody


Western Blot analysis using KIAA0157 antibody (70R-4247)

KIAA0157 antibody (70R-4247) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 47 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of KIAA0157 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance KIAA0157 is a component of the BRISC complex, a multiprotein complex that specifically cleaves 'Lys-63'-linked ubiquitin. It may act as a central scaffold protein that assembles the various components of the BRISC complex.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using KIAA0157 antibody (70R-4247) | KIAA0157 antibody (70R-4247) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors