KIAA0427 antibody (70R-4775)

Rabbit polyclonal KIAA0427 antibody raised against the N terminal of KIAA0427

Synonyms Polyclonal KIAA0427 antibody, Anti-KIAA0427 antibody, KIAA0-427 antibody, Gm672 antibody, Kiaa0427 antibody, KIAA0-427, KIAA0 427 antibody, KIAA0427, KIAA0 427
Specificity KIAA0427 antibody was raised against the N terminal of KIAA0427
Cross Reactivity Human,Rat
Applications WB
Immunogen KIAA0427 antibody was raised using the N terminal of KIAA0427 corresponding to a region with amino acids SSCSFSRGRAPPQQNGSKDNSLDMLGTDIWAANTFDSFSGATWDLQPEKL
Assay Information KIAA0427 Blocking Peptide, catalog no. 33R-8789, is also available for use as a blocking control in assays to test for specificity of this KIAA0427 antibody

Images

Western Blot analysis using KIAA0427 antibody (70R-4775)

KIAA0427 antibody (70R-4775) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 67 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of KIAA0427 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance CTIF is a component of the CBP80/CBP20 translation initiation complex that binds cotranscriptionally to the cap end of nascent mRNA. The CBP80/CBP20 complex is involved in a simultaneous editing and translation step that recognises premature termination codons (PTCs) in mRNAs and directs PTC-containing mRNAs toward nonsense-mediated decay.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using KIAA0427 antibody (70R-4775) | KIAA0427 antibody (70R-4775) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
OR
Shipping
View Our Distributors