KIAA0494 antibody (70R-1815)

Rabbit polyclonal KIAA0494 antibody raised against the N terminal of KIAA0494

Synonyms Polyclonal KIAA0494 antibody, Anti-KIAA0494 antibody, Kiaa0494 antibody, KIAA0-494 antibody, KIAA0494, KIAA0-494, RP11-8J9.3 antibody, KIAA0 494 antibody, KIAA0 494
Specificity KIAA0494 antibody was raised against the N terminal of KIAA0494
Cross Reactivity Human,Mouse,Rat,Dog
Applications IHC, WB
Immunogen KIAA0494 antibody was raised using the N terminal of KIAA0494 corresponding to a region with amino acids DLDALKEKFRTMESNQKSSFQEIPKLNEELLSKQKQLEKIESGEMGLNKV
Assay Information KIAA0494 Blocking Peptide, catalog no. 33R-2036, is also available for use as a blocking control in assays to test for specificity of this KIAA0494 antibody


Western Blot analysis using KIAA0494 antibody (70R-1815)

KIAA0494 antibody (70R-1815) used at 5 ug/ml to detect target protein.


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 55 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of KIAA0494 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 5 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance KIAA0494 is involved in calcium ion binding.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using KIAA0494 antibody (70R-1815) | KIAA0494 antibody (70R-1815) used at 5 ug/ml to detect target protein.
  • Immunohistochemical staining using KIAA0494 antibody (70R-1815) | KIAA0494 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Decidual cells (arrows) in Human Placenta. Magnification is at 400X

Availability: In stock

Price: £220.34
Size: 100 ug
View Our Distributors