KIAA0515 antibody (70R-3603)

Rabbit polyclonal KIAA0515 antibody raised against the N terminal of KIAA0515

Synonyms Polyclonal KIAA0515 antibody, Anti-KIAA0515 antibody, KIAA-515, DKFZp781F05101 antibody, RP11-334J6.1 antibody, Kiaa0515 antibody, MGC10526 antibody, KIAA 0515 antibody, DKFZp781K12107 antibody, LQFBS-1 antibody, KIAA 0515, KIAA-515 antibody, KIAA0515
Specificity KIAA0515 antibody was raised against the N terminal of KIAA0515
Cross Reactivity Human,Mouse
Applications WB
Immunogen KIAA0515 antibody was raised using the N terminal of KIAA0515 corresponding to a region with amino acids ATASQPPESLPQPGLQKSVSNLQKPTQSISQENTNSVPGGPKSWAQLNGK
Assay Information KIAA0515 Blocking Peptide, catalog no. 33R-1551, is also available for use as a blocking control in assays to test for specificity of this KIAA0515 antibody

Images

Western Blot analysis using KIAA0515 antibody (70R-3603)

KIAA0515 antibody (70R-3603) used at 0.25 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 48 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of KIAA0515 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.25 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of KIAA0515 protein is not widely studied, and is yet to be elucidated fully.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using KIAA0515 antibody (70R-3603) | KIAA0515 antibody (70R-3603) used at 0.25 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
OR
Shipping
View Our Distributors