KIAA0892 antibody (70R-4236)

Rabbit polyclonal KIAA0892 antibody raised against the middle region of KIAA0892

Synonyms Polyclonal KIAA0892 antibody, Anti-KIAA0892 antibody, KIAA 0892 antibody, MGC75361 antibody, Kiaa0892 antibody, MAU2L antibody, KIAA-892 antibody, KIAA-892, KIAA0892, mau-2 antibody, KIAA 0892
Specificity KIAA0892 antibody was raised against the middle region of KIAA0892
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen KIAA0892 antibody was raised using the middle region of KIAA0892 corresponding to a region with amino acids MHQNFSQQLLQDHIEACSLPEHNLITWTDGPPPVQFQAQNGPNTSLASLL
Assay Information KIAA0892 Blocking Peptide, catalog no. 33R-6099, is also available for use as a blocking control in assays to test for specificity of this KIAA0892 antibody

Images

Western Blot analysis using KIAA0892 antibody (70R-4236)

KIAA0892 antibody (70R-4236) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 69 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of KIAA0892 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance KIAA0892 belongs to the mau-2 family. It contains 4 TPR repeats. The function of KIAA0892 remains unknown.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using KIAA0892 antibody (70R-4236) | KIAA0892 antibody (70R-4236) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
OR
Shipping
View Our Distributors