KIAA1199 antibody (70R-5460)

Rabbit polyclonal KIAA1199 antibody raised against the middle region of KIAA1199

Synonyms Polyclonal KIAA1199 antibody, Anti-KIAA1199 antibody, Kiaa1199 antibody, KIAA-1199 antibody, KIAA1199, TMEM2L antibody, KIAA 1199, KIAA 1199 antibody, KIAA-1199
Specificity KIAA1199 antibody was raised against the middle region of KIAA1199
Cross Reactivity Human
Applications WB
Immunogen KIAA1199 antibody was raised using the middle region of KIAA1199 corresponding to a region with amino acids PFLSIISARYSPHQDADPLKPREPAIIRHFIAYKNQDHGAWLRGGDVWLD
Assay Information KIAA1199 Blocking Peptide, catalog no. 33R-7080, is also available for use as a blocking control in assays to test for specificity of this KIAA1199 antibody


Western Blot analysis using KIAA1199 antibody (70R-5460)

KIAA1199 antibody (70R-5460) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 153 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of KIAA1199 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance KIAA1199 may function as a tumor suppressor.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using KIAA1199 antibody (70R-5460) | KIAA1199 antibody (70R-5460) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £272.51
Size: 50 ug
View Our Distributors