KIAA1704 antibody (70R-4073)

Rabbit polyclonal KIAA1704 antibody raised against the middle region of KIAA1704

Synonyms Polyclonal KIAA1704 antibody, Anti-KIAA1704 antibody, bA245H20.2 antibody, LSR7 antibody, KIAA1704, KIAA 1704, KIAA 1704 antibody, KIAA-1704 antibody, AD029 antibody, RP11-245H20.2 antibody, KIAA-1704, Kiaa1704 antibody
Specificity KIAA1704 antibody was raised against the middle region of KIAA1704
Cross Reactivity Human
Applications WB
Immunogen KIAA1704 antibody was raised using the middle region of KIAA1704 corresponding to a region with amino acids KAAEDKNKPQERIPFDRDKDLKVNRFDEAQKKALIKKSRELNTRFSHGKG
Assay Information KIAA1704 Blocking Peptide, catalog no. 33R-4232, is also available for use as a blocking control in assays to test for specificity of this KIAA1704 antibody

Images

Western Blot analysis using KIAA1704 antibody (70R-4073)

KIAA1704 antibody (70R-4073) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 38 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of KIAA1704 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of KIAA1704 protein is not widely studied, and is yet to be elucidated fully.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using KIAA1704 antibody (70R-4073) | KIAA1704 antibody (70R-4073) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
OR
Shipping
View Our Distributors