KIAA1958 antibody (70R-4141)

Rabbit polyclonal KIAA1958 antibody raised against the C terminal of KIAA1958

Synonyms Polyclonal KIAA1958 antibody, Anti-KIAA1958 antibody, FLJ39294 antibody, MGC142075 antibody, KIAA-1958, Kiaa1958 antibody, KIAA-1958 antibody, KIAA 1958, KIAA 1958 antibody, KIAA1958, RP11-276E15.5 antibody
Specificity KIAA1958 antibody was raised against the C terminal of KIAA1958
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen KIAA1958 antibody was raised using the C terminal of KIAA1958 corresponding to a region with amino acids SPITLLSTVVKYNSQYLNMRTLQEHADLMYGDIELLKDPQNQPYFARTDS
Assay Information KIAA1958 Blocking Peptide, catalog no. 33R-8678, is also available for use as a blocking control in assays to test for specificity of this KIAA1958 antibody

Images

Western Blot analysis using KIAA1958 antibody (70R-4141)

KIAA1958 antibody (70R-4141) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 62 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of KIAA1958 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of KIAA1958 protein has not been widely studied, and is yet to be fully elucidated.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using KIAA1958 antibody (70R-4141) | KIAA1958 antibody (70R-4141) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
OR
Shipping
View Our Distributors