KIF1A antibody (70R-5534)

Rabbit polyclonal KIF1A antibody raised against the N terminal of KIF1A

Synonyms Polyclonal KIF1A antibody, Anti-KIF1A antibody, KIFA 1, MGC133286 antibody, UNC104 antibody, ATSV antibody, MGC133285 antibody, KIFA-1 antibody, HUNC-104 antibody, KIFA-1, KIFA 1 antibody, KIF1A, FLJ30229 antibody, C2orf20 antibody, DKFZp686I2094 antibody, Kinesin Family Member 1A antibody
Specificity KIF1A antibody was raised against the N terminal of KIF1A
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen KIF1A antibody was raised using the N terminal of KIF1A corresponding to a region with amino acids TTIVNPKQPKETPKSFSFDYSYWSHTSPEDINYASQKQVYRDIGEEMLQH
Assay Information KIF1A Blocking Peptide, catalog no. 33R-9321, is also available for use as a blocking control in assays to test for specificity of this KIF1A antibody

Images

Western Blot analysis using KIF1A antibody (70R-5534)

KIF1A antibody (70R-5534) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 191 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of KIF1A antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The protein encoded by this gene is a member of the kinesin family. This protein is highly similar to mouse heavy chain kinesin member 1A protein which is an anterograde motor protein that transports membranous organelles along axonal microtubules. It is thought that this protein may play a critical role in the development of axonal neuropathies resulting from impaired axonal transport.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using KIF1A antibody (70R-5534) | KIF1A antibody (70R-5534) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
OR
Shipping
View Our Distributors