KIF2A antibody (70R-5532)

Rabbit polyclonal KIF2A antibody raised against the C terminal of KIF2A

Synonyms Polyclonal KIF2A antibody, Anti-KIF2A antibody, KIFA 2, KIFA-2, Kinesin Heavy Chain Member 2A antibody, HK2 antibody, KIFA 2 antibody, KIF2A, KIFA-2 antibody, KIF2 antibody
Specificity KIF2A antibody was raised against the C terminal of KIF2A
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen KIF2A antibody was raised using the C terminal of KIF2A corresponding to a region with amino acids ETQWGVGSSPQRDDLKLLCEQNEEEVSPQLFTFHEAVSQMVEMEEQVVED
Assay Information KIF2A Blocking Peptide, catalog no. 33R-2768, is also available for use as a blocking control in assays to test for specificity of this KIF2A antibody


Western Blot analysis using KIF2A antibody (70R-5532)

KIF2A antibody (70R-5532) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 80 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of KIF2A antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance KIF2A belongs to the kinesin-like protein family, MCAK/KIF2 subfamily. It contains 1 kinesin-motor domain. KIF2A plus end-directed microtubule-dependent motor required for normal brain development. It may regulate microtubule dynamics during axonal growth. KIF2A is implicated in formation of bipolar mitotic spindles. It has microtubule depolymerization activity. Hela cells lacking KIF2A show asymmetric or monopolar mitotic spindles. Osteosarcoma cells (U2OS) lacking KIF2A or KIF2B show disorganised or monopolar mitotic spindles.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using KIF2A antibody (70R-5532) | KIF2A antibody (70R-5532) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors