KIF2C antibody (70R-5591)

Rabbit polyclonal KIF2C antibody raised against the N terminal of KIF2C

Synonyms Polyclonal KIF2C antibody, Anti-KIF2C antibody, KIF2C, KNSL6 antibody, MCAK antibody, Kinesin Family Member 2C antibody, KIFC-2 antibody, KIFC 2 antibody, KIFC 2, KIFC-2
Specificity KIF2C antibody was raised against the N terminal of KIF2C
Cross Reactivity Human
Applications WB
Immunogen KIF2C antibody was raised using the N terminal of KIF2C corresponding to a region with amino acids LHPKDNLPLQENVTIQKQKRRSVNSKIPAPKESLRSRSTRMSTVSELRIT
Assay Information KIF2C Blocking Peptide, catalog no. 33R-5021, is also available for use as a blocking control in assays to test for specificity of this KIF2C antibody

Images

Western Blot analysis using KIF2C antibody (70R-5591)

KIF2C antibody (70R-5591) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 81 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of KIF2C antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance KIF2C is a member of kinesin-like protein family. Proteins of this family are microtubule-dependent molecular motors that transport organelles within cells and move chromosomes during cell division. It is important for anaphase chromosome segregation and may be required to coordinate the onset of sister centromere separation.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using KIF2C antibody (70R-5591) | KIF2C antibody (70R-5591) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
OR
Shipping
View Our Distributors