KIFAP3 antibody (70R-3387)

Rabbit polyclonal KIFAP3 antibody raised against the middle region of KIFAP3

Synonyms Polyclonal KIFAP3 antibody, Anti-KIFAP3 antibody, SMAP antibody, KAP3 antibody, dJ190I16.1 antibody, FLJ22818 antibody, Kinesin-Associated Protein 3 antibody, Smg-GDS antibody
Specificity KIFAP3 antibody was raised against the middle region of KIFAP3
Cross Reactivity Human
Applications WB
Immunogen KIFAP3 antibody was raised using the middle region of KIFAP3 corresponding to a region with amino acids WLEMVESRQMDESEQYLYGDDRIEPYIHEGDILERPDLFYNSDGLIASEG
Assay Information KIFAP3 Blocking Peptide, catalog no. 33R-9969, is also available for use as a blocking control in assays to test for specificity of this KIFAP3 antibody

Images

Western Blot analysis using KIFAP3 antibody (70R-3387)

KIFAP3 antibody (70R-3387) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 91 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of KIFAP3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The protein encoded by this gene contains 9 'Armadillo' repeats and interacts with the smg GDS protein through these repeats. This protein, which is highly concentrated around the endoplasmic reticulum, is phosphorylated by v-src, and this phosphorylation reduces the affinity of the protein for smg GDS. It is thought that this protein serves as a linker between human chromosome-associated polypeptide (HCAP) and KIF3A/B, a kinesin superfamily protein in the nucleus, and that it plays a role in the interaction of chromosomes with an ATPase motor protein.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using KIFAP3 antibody (70R-3387) | KIFAP3 antibody (70R-3387) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
OR
Shipping
View Our Distributors