KIFC2 antibody (70R-1631)

Rabbit polyclonal KIFC2 antibody raised against the N terminal of KIFC2

Synonyms Polyclonal KIFC2 antibody, Anti-KIFC2 antibody, Kinesin Family Member C2 antibody
Specificity KIFC2 antibody was raised against the N terminal of KIFC2
Cross Reactivity Human
Applications IHC, WB
Immunogen KIFC2 antibody was raised using the N terminal of KIFC2 corresponding to a region with amino acids VRPPSPDGSTSQEESPSHFTAVPGEPLGDETQGQQPLQLEEDQRAWQRLE
Assay Information KIFC2 Blocking Peptide, catalog no. 33R-9783, is also available for use as a blocking control in assays to test for specificity of this KIFC2 antibody


Immunohistochemical staining using KIFC2 antibody (70R-1631)

KIFC2 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Skeletal muscle cells (lndicated with Arrows) in Human Muscle. Magnification is at 400X


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 90 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of KIFC2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Members of the kinesin superfamily of microtubule-associated proteins are involved in a variety of intracellular processes including cell division and organelle transport. KIFC2 encodes a 792 amino acid protein, which contains the conserved motor domain at the C-terminal end of the protein and is most similar to members of the KAR3 family involved in cell division.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunohistochemical staining using KIFC2 antibody (70R-1631) | KIFC2 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Skeletal muscle cells (lndicated with Arrows) in Human Muscle. Magnification is at 400X
  • Western Blot analysis using KIFC2 antibody (70R-1631) | KIFC2 antibody (70R-1631) used at 1.25 ug/ml to detect target protein.

Availability: In stock

Price: £220.34
Size: 100 ug
View Our Distributors