KIR2DL4 antibody (70R-2365)

Rabbit polyclonal KIR2DL4 antibody raised against the middle region of KIR2DL4

Synonyms Polyclonal KIR2DL4 antibody, Anti-KIR2DL4 antibody, KIRDL4-2, KIR2DL4, CD158D antibody, KIR103AS antibody, KIRDL4 2 antibody, KIRDL4-2 antibody, G9P antibody, KIRDL4 2, Killer Cell Immunoglobulin-Like Receptor Two Domains Long Cytoplasmic Tail 4 antibody, KIR103 antibody
Specificity KIR2DL4 antibody was raised against the middle region of KIR2DL4
Cross Reactivity Human
Applications WB
Immunogen KIR2DL4 antibody was raised using the middle region of KIR2DL4 corresponding to a region with amino acids VSVTGNPSSSWPSPTEPSFKTGIARHLHAVIRYSVAIILFTILPFFLLHR
Assay Information KIR2DL4 Blocking Peptide, catalog no. 33R-9831, is also available for use as a blocking control in assays to test for specificity of this KIR2DL4 antibody


Western Blot analysis using KIR2DL4 antibody (70R-2365)

KIR2DL4 antibody (70R-2365) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 30 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of KIR2DL4 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Killer cell immunoglobulin-like receptors (KIRs) are transmembrane glycoproteins expressed by natural killer cells and subsets of T cells.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using KIR2DL4 antibody (70R-2365) | KIR2DL4 antibody (70R-2365) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors