KLHL2 antibody (70R-4468)

Rabbit polyclonal KLHL2 antibody

Synonyms Polyclonal KLHL2 antibody, Anti-KLHL2 antibody, Kelch-Like 2 Mayven antibody, MAYVEN antibody, KLHL 2 antibody, KLHL2, ABP-KELCH antibody, KLHL-2 antibody, KLHL 2, KLHL-2, MAV antibody
Cross Reactivity Human
Applications WB
Immunogen KLHL2 antibody was raised using a synthetic peptide corresponding to a region with amino acids TYAEQHFADVVLSEEFLNLGIEQVCSLISSDKLTISSEEKVFEAVIAWVN
Assay Information KLHL2 Blocking Peptide, catalog no. 33R-9385, is also available for use as a blocking control in assays to test for specificity of this KLHL2 antibody


Western Blot analysis using KLHL2 antibody (70R-4468)

KLHL2 antibody (70R-4468) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 66 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of KLHL2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance KLHL2 may play a role in organizing the actin cytoskeleton of the brain cells.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using KLHL2 antibody (70R-4468) | KLHL2 antibody (70R-4468) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors